SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005749 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005749
Domain Number 1 Region: 1138-1333
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.61e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000236
Further Details:      
 
Domain Number 2 Region: 928-1051
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-31
Family Pleckstrin-homology domain (PH domain) 0.000000655
Further Details:      
 
Domain Number 3 Region: 34-160
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005749   Gene: ENSDORG00000006139   Transcript: ENSDORT00000006141
Sequence length 1920
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1552:4237:93896:-1 gene:ENSDORG00000006139 transcript:ENSDORT00000006141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRPTGLPEGDGDKLKAHGASKNKDGKEQSEIVSPSEDEPFSWPGPKTVLLKRTSQGFG
FTLRHFIVYPPESAIQFACKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTG
DRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDA
YLKGNEAYSGNARNIPEPPPVCYPWLPSAPPAMAQPVEVSPPDSSVSKQQTSTPVLTQPG
RAYRMEIQVPPSPTDVAKSNTAVCVCNESIRTVIVPSEKAVDLLSNRNNHTGPSHRTEEV
RYGVTEQTSLKSASRTTSPSSIPTAHLIHQTSGSRALEPSGMLLKSGHSEGLSGSRSQVV
DSPSVPVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQSTTDYN
QVIPTRTTLHVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALTSSSV
SFSNHRTRSWDYIEGQGEALENVNSENQTPDSNGERKQTYNWSGFTEQDDRRGIYERPRQ
QEIHKSFRGSNLTVAPSIVNSDNRRVSGRGVGSVSQFRKIPPDLKPLQSNRNFQTTSGMS
LARGISQDRSPLMKVRSNSLKAPSTHVSKLSFSQNSLVSIKDQRPVNHLHQNSVLGQQTW
FRTESTPNHQAETGKSLCVSGASAKPGPQMKEHLGTSDLELSVSQRNDDLNLQEVEGQPS
NALDNKEPVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVHIKRM
EERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHISASAVISASTSQVPSIATVPPSLT
TSAPLIRRQLSHDQESVGPPSLDAQPTSKTERSKSYDEGLDDYREDAKXXXXXXXXXXXX
XILDSQKSSEDSESRKDSSSEVFTDAAKEGWLQFRPLITDKGKRVGGSIRPWKQMYVVLR
GHSLYLYKDKREQLPPAEEEQPISVNACLIDISYSDTKRKNVFRLTTSDCECLFQAEDRD
DMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQTLSIRQTLL
GAKSEQKSQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPTATGTFG
VRLDDCPPAHTNRFIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMADI
DIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLERLKTLKRLIHDL
PEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYK
IVETLIQHHDWFFTEEGAEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGASPGDVSDSA
TSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNVFFKKEN
ADQGHQESKEEPPRESETPGRKQRIVGTKEQSARREPAAREGRVAVRPERAPSEERTPPA
APGPPPPPKASPCEDAGSDAGTLPRAASQAPLARLATKKPTSPDARHGELLANVGTLPSD
HSTPVSAAPGVTSLDSSRLSPEVQSVAESKGDEADDERSELVSEGRPVETDSESDFPVFP
SALAPDRLLPRGRGPESAKGGRRNSEGSEASCAEGSWPSLNCRPLFSSHKLIECDTLSRK
KSARFKSDSGGLGEPKAERDAPSVAKVFDVMKKGKSTGSLLLTPSRGEAEPTWRTKIADR
LKLRPRAPAADDMFAVGNPKSETGKRKNIKRRHTLGGHRDATEISVLNFWKTHDASGGEQ
REPELSAVNRLKPKCPAQDLSISDWLARQRLRTSTGDLSRGDPENPGLLETSNPDPPSTP
HASGSPPGPRPSLSTAPQSPDQINGESVQNMSHHASSVAAVCPHKLADAPGTKAQIHPCL
Download sequence
Identical sequences ENSDORP00000005749 ENSDORP00000005749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]