SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005807 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005807
Domain Number 1 Region: 9-90
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-21
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 94-145
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000595
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 3 Region: 406-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000095
Family SPRY domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005807   Gene: ENSDORG00000006202   Transcript: ENSDORT00000006203
Sequence length 476
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4136:9082:30395:-1 gene:ENSDORG00000006202 transcript:ENSDORT00000006203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVELARKLQEEATCSICLDYFTDPVMTSCGHNFCRECIRMTWEKAKGKKGKRRQKGSF
PCPECREMSPQRNLRPNRLLTKVAEMARQHPGLQRRDLCPAHQEPLKLFCLEEQTPICVV
CREAREHQSHRALPVDEAVQEYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKAKE
RRERILVEFQKVVLFLVEEERRLLQTLKKEEEETVMKLQDSKASLDRQNHSLHSLLLQLE
DWSREDPIQMLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSAPVTLIGPPSFVGV
FLDFSPEHIFFQSARSVHMHTYWQVAFSEPLQPFFLLGAPKSGQMVISTVTMWVKG
Download sequence
Identical sequences ENSDORP00000005807 ENSDORP00000005807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]