SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006171 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006171
Domain Number 1 Region: 291-531
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-54
Family Nuclear receptor ligand-binding domain 0.0000000105
Further Details:      
 
Domain Number 2 Region: 76-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-28
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006171   Gene: ENSDORG00000006587   Transcript: ENSDORT00000006588
Sequence length 533
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2054:7651:109231:1 gene:ENSDORG00000006587 transcript:ENSDORT00000006588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNSDTGDFQESLKLGFTPIGAGLAHRPGLVMLPKVETEALALARAHGDQGQMPEAMQV
SQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNC
QIDKTQRKRCPYCRFQKCLSVGMKLAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRAN
GLKLEAMSQVIQAMPSELSISSAIQNIHSASKGLPLNHTALPPTDYDRSPFVTSPISMTM
PPPNSLPAYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPQLILELM
KCEPDEPQVQGKIMAHLQQEQANRGKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFKEL
KVDDQMKLLQNCWSELLILDHIYRQVVHGKEGCIFLVTGQQVDYSLVASQAGATLHSLLS
HAQELVTKLRSLQFDQRDFVCLKFLVLFSSXXXXXXXXXXXXXXXXXXHNNALLEYTTCN
YPQHTQKFPQLVLLLPEIRQISIQAEDYLYFKHLNGDVPYNNLLIEMLHAKRA
Download sequence
Identical sequences ENSDORP00000006171 ENSDORP00000006171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]