SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006224 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006224
Domain Number 1 Region: 17-154
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-25
Family C-type lectin domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006224   Gene: ENSDORG00000006643   Transcript: ENSDORT00000006642
Sequence length 165
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3069:40880:55421:-1 gene:ENSDORG00000006643 transcript:ENSDORT00000006642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAALPALLLPLLGLSTAALADCPSSTWIQFQNSCYIFLEEAIKVESIEDVRNQCTGHG
ADMISIHTEEENAFILNTLKQQWNGPEDVLLGMFYDTDDASFKWFDNSNMTFDKWAEEED
GEDLVDTCGFLYTKTGEWKKGNCEISSVQGTLCKAAIPFDKKYLS
Download sequence
Identical sequences ENSDORP00000006224 ENSDORP00000006224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]