SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006248 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006248
Domain Number 1 Region: 761-1016
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-86
Family Eukaryotic proteases 0.0000000518
Further Details:      
 
Domain Number 2 Region: 346-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-35
Family MAM domain 0.0036
Further Details:      
 
Domain Number 3 Region: 521-631
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-29
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 4 Region: 226-336
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-16
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 5 Region: 671-773
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000012
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0092
Further Details:      
 
Domain Number 6 Region: 59-116
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000157
Family SEA domain 0.0079
Further Details:      
 
Domain Number 7 Region: 637-676
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 182-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006248   Gene: ENSDORG00000006666   Transcript: ENSDORT00000006666
Sequence length 1017
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4143:4396:94551:-1 gene:ENSDORG00000006666 transcript:ENSDORT00000006666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRTVSCPNHSLSSYEIMFAALFALLMVICVGLIAISWVTIEESGKDEELGKSHETKG
TFKITSGATYNPNLQDELSVDFKVLAFDLQQMIDDIFQSSNLKDQYKSSRVLRFXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLTTSHPLATPGNV
SIECPAGSRPCGADVPKCIAINLFCDGEINCPDGADEDKELCATACDGRFLLTGSSGSFQ
AVHYPPLATSSSIICQWIIRVKQGLSIQLSFDSFNTYYSDVLNIYEGVGPSKILRASLWE
TDPGIIRIFSNHITATFVIQSDENDYIGFSATYTTFNSSKLNNYEKINCHFEDGFCYWIQ
DLNDDNEWERIQGVTFPPTTGPNFDHTFGNNSGFYISTPTFQGGRRERVGLLSLPLKPTL
EPVCLSFWYFMYGVNVYRLSINITSGENLEKTIFQKEGNYGENWNYGQVTLNETVEFKVT
FNAIKNPFLSDIALDDINLTYGICNESVSETLVLLSPEPTDCGGPFELWEPNTTFSSPNF
PNNYPNQAFCVWNLNAQKGKNIQVHFQEFDLENVVDVVEIRDGAEDESSLLAVYTGPGPV
KDVFSTSNKMAVLFITDNSLTRKGFKANFTTGYHLGMPEPCKDDTFQCENGECVPLVNLC
DGQPHCKDGSDEAHCVRLSNGTMSNNGLVQFRIQAKWHVACAENWTKEISNDVCHLLGLG
SGNSSMPIFSTRGGPFVKLSKAPNSSLILTPSQQCFQDSLIHLQCNHKSCGRKLVTPEVS
PKVVGGSNAEAGAWPWLTALYYRDQLVCGASLVSREWLVSAAHCVYGRNVDPSRWKAFLG
LHMKSNLTSPHIVTRLIDQIVINPHYNKRTKNNDIAMMHLEFKVNYTDYIQPICLPEENQ
VFLPGRNCSIAGWGTVVHQGPTANILQEANVPLLSNEKCQQQMPEYNITENMICAGYEEG
GIDSCQGDSGGPLMCQDDNSWVLAGVTSFGYQCARPHRPGVYARVPGFTEWIQSFLH
Download sequence
Identical sequences ENSDORP00000006248 ENSDORP00000006248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]