SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006274 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006274
Domain Number 1 Region: 87-340
Classification Level Classification E-value
Superfamily C-type lectin-like 5.09e-91
Family Sulfatase-modifying factor-like 0.000000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006274   Gene: ENSDORG00000006695   Transcript: ENSDORT00000006695
Sequence length 425
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1040:8133:132884:-1 gene:ENSDORG00000006695 transcript:ENSDORT00000006695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALANSSGSRARLRGVFFLPLFLLACGAAGSEEAGPGAGAAALAGSCGCGTPQRPGA
RGGSAAAAHRYSREANAPPGPVPRGRAPPKMVAIPAGVFMMGTDDPQIKQDGEAPARRVT
IDAFYMDAYEVSNAEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTDIQQAVAAAPWW
LPVKGADWRHPEGPDSTVLHRPDHPVLHVSWNDAVAYCAWAGKRLPTEAEWEYSCRGGLH
NRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFRGTAPVDTFPPNGYGLYNIVGNVWE
WTADWWTVHHSAEDMPNPKGPPSGKDRVKKGGSYMCHKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKRHCLCVFFCTCSTGQYIARL
LSVDS
Download sequence
Identical sequences ENSDORP00000006274 ENSDORP00000006274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]