SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006422 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006422
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.64e-38
Family Laminin G-like module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006422
Domain Number - Region: 1584-1639
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00837
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006422   Gene: ENSDORG00000006853   Transcript: ENSDORT00000006855
Sequence length 1793
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2652:6143:117553:1 gene:ENSDORG00000006853 transcript:ENSDORT00000006855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPADLLKVLDFHNLPDGITKTTGFCATRRSAKGPDVAYRVTKEAQLSAPTKQLYPASAFP
EDFSILTTVKARKGSQAFLVSIYNEQGIQQVGLEMGRSPVFLYEDHMGKPGPEDYPLFRG
INLSDGKWHRIALSVHKKNVTLILDCKKKITKFLDRSDHPMVDVNGIIVFGTRILDEEVF
EGDIQQLLFVSDHRAAYDYCEHYSPDCDTAVPDTPQSQDPNPDDYXXXXXXXXXXXXYEY
PYYEDPEDPRKELTPKKPVAARETTEIPEELTQPPTEAPTVPEMSNRAGKEEDPGIGDYD
YVPIDDYYTPSPYEDLNYGEGVESPEGPLDPDTGPEVPTSTTVASNGSNPAPPPGEGKDD
QEGEFTEETIKNLDENYYDPYYDPDHDSSTNPSEIGPGMPANQDTIFEGIGGPRGEKGQK
GEPAIIEPGMLIEGPPGPEGPAGLPGPPGTTGPTGQVGDPGERGPPGRPGLPGADGLPGP
PGTMLMLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLALRGPAGPMGLTGRPGPMGP
PGSGGLKGEPGDMGPQGPRGVQGPPGPAGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGL
AGLPGEKGHRGDPGPSGPPGPPGDDGERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGP
PGVTGMCHSPKGNVGPQGEPGPPGQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPG
ADGPPGHPGKEALQEEKRQGPPGPQGPIGYPGPRGVKPGDRASGFGRRGEDGFPGFKGDM
GIKGDRGEIGPPGPRGEDGPEGPKGRGGPNGDPGLLGPTGEKGKLGVPGLPGYPGRQGPK
GSIGFPGFPGANGEKGGRGTPKPGPRGQRGPTXXXXXXXXXXXXXXXXXXGNSGGDGPAG
PPGERGPSGPQGPTGFPGPRPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGP
TGETGPMGERGHPGPPGPPGEQGLPGVAGKEGTKDPGPAGLPGKDGPPGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGAPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEIGEPGQKGSKGDKGEQGPPGPTGPQ
GPIGQPGPSGADGEPGPRGQQGLFGQKGDEGSRGFPGPPGPVGLQGLPGPPGEKGETGDV
GQMGPPGPPGPRGPSGAPGADGPQGPPGGVGNPGAVGEKGEPGEGGEPGLPGEGGPPGPK
GERGEKGEAGPSGAAGPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDK
GDDGEPGQTGSPGPTGEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPI
GPQGAPGKPGPDGLRGIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHP
GLIGLIGPPGEQGEKGDRGLPGPQGSSGPKGEQGITGPSGPLGPPGPPGLPGPPGPKGAK
GSSGPTGPKGETGHPGLPGPPGPPGEVIQPLPMQASRTRRNIDASQLLDDGAGENYMDYA
DGMEEIFGSLNSLKLEIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRD
SFKVYCNFTAGGATCVFPDKKSEGSRITSWPKENPGSWFSEFKRGKLLSYVDAEGNPVGV
VQMTFLRLLSASAQQNVTYNCYQSVAWQDAATGTYDKAIRFLGSNDEEMSHDNSPYIRAL
VDGCATKKGYQKTVLEIDTPKVEQVPIVDIMFNDFGEASQKFGFEVGPACFLG
Download sequence
Identical sequences ENSDORP00000006422 ENSDORP00000006422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]