SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006473 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006473
Domain Number 1 Region: 49-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000017
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006473   Gene: ENSDORG00000006908   Transcript: ENSDORT00000006907
Sequence length 412
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_13392:29190:33346:-1 gene:ENSDORG00000006908 transcript:ENSDORT00000006907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPSAQPPPACLPKTPVLEPGDLPGMDFAHMYQVYKSRRGLKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGELSGRNVEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVAHLHRVVS
ELLQGGTGRKPSDSVSKAMDLKEKSSSLVRGSEGPGKNCVPVIQRTFAASSGEQSGSDTD
TDSGYGGESEKGDLRGEQPYFKGDLGRRFTLGERVSTIKQECEEPPSKKSRMQLPEDEGH
FPTSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPILYPGLNTSAA
ALTSFMNPDKISAPLLMPQRLPSPLTAHPSLDSSALLQALKQIPPLNLETKD
Download sequence
Identical sequences A0A1S3ENJ2
ENSDORP00000006473 ENSDORP00000006473 XP_012865953.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]