SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006559 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006559
Domain Number 1 Region: 16-128
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-32
Family C-type lectin domain 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006559   Gene: ENSDORG00000006997   Transcript: ENSDORT00000006997
Sequence length 129
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_5452:65569:66496:-1 gene:ENSDORG00000006997 transcript:ENSDORT00000006997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGEREEAFSLGKMPEKKFYVTNGKKVPFTKAKFLCTELGATVAVPKNAEENRAIQSVAKD
ATFLGITDEEVEGTFTYVTGGGRLVYSNWKENEPNDYGSGEDCVCMRVDGLWNDISCTTS
LNFVCEFPA
Download sequence
Identical sequences ENSDORP00000006559 ENSDORP00000006559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]