SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006597 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006597
Domain Number 1 Region: 183-197,323-584
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-63
Family Nuclear receptor ligand-binding domain 0.0000685
Further Details:      
 
Domain Number 2 Region: 114-196
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006597   Gene: ENSDORG00000007038   Transcript: ENSDORT00000007037
Sequence length 596
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4778:29788:62715:1 gene:ENSDORG00000007038 transcript:ENSDORT00000007037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSSKQQFILTSPDGAG
AGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEM
GMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVAEKDGARQTGLL
DPGMLVNIQQPLIREDGTVLLAADSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQ
PEDQSASEITRAFDTLAKALNTTDSSSPPSLADGIDASGGGSIHVISRDQSTPIIEVEGP
LLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKLDIDGYEYAYLKAIVLFSPDHPGLTGTSQIEKFQEKAQMELQDYVQKTYSEDTYRL
ARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL
Download sequence
Identical sequences A0A1S3EPX2
XP_012865979.1.60039 ENSDORP00000006597 ENSDORP00000006597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]