SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006776 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006776
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.43e-22
Family Dual specificity phosphatase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006776   Gene: ENSDORG00000007227   Transcript: ENSDORT00000007227
Sequence length 180
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1828:11483:76542:1 gene:ENSDORG00000007227 transcript:ENSDORT00000007227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGMNKILPGLYIGNFKDARDMEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLXXXXXXXXXXXXXXXXXXXXXXXXXLAGVSRSVTLVIAYIMVVTDFGWEDALHTVRA
GRSCANPNLGFQRQLEEFEKCEVQQYQLKEEYGEKLRDAEEANILATPGILKYWSFLRRL
Download sequence
Identical sequences ENSDORP00000006776 ENSDORP00000006776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]