SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006787 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006787
Domain Number 1 Region: 3642-3784
Classification Level Classification E-value
Superfamily SET domain 4.84e-48
Family Histone lysine methyltransferases 0.0044
Further Details:      
 
Domain Number 2 Region: 1400-1468
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000377
Family PHD domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1315-1376
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000179
Family PHD domain 0.022
Further Details:      
 
Domain Number 4 Region: 1537-1601
Classification Level Classification E-value
Superfamily Bromodomain 0.00000523
Family Bromodomain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006787   Gene: ENSDORG00000007239   Transcript: ENSDORT00000007241
Sequence length 3787
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5591:48895:96700:1 gene:ENSDORG00000007239 transcript:ENSDORT00000007241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTSPRKPRGRPRSGSDRNSAILPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQ
FIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSRFSATSCGSSEKSSAASQH
SSQLSSDSSRSSSPSIDTTTDSQASEEAQALPEERSDTPEVHTPLPVSQSPENESSERRS
RRYSVSERSFGSRTTKKLSALQSAPQQQPSSSPPPPLLTPPPPLQPASGISDHTPWLMPP
TIPLASPFLPASAASLQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIF
DNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAH
SRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSTSELS
PLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESTEKSQRARKQTSAPSSEPF
SSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRE
SRKEKRKKGSEIQSSSALYPMGRVSKEKVVGEDGATSSSAKKATGRKKSSSLDSGTDLAS
VTLGDTTAVKTKILIKKGRGNLEKNNLDLGPTAPSLEKEKALCLSTPSSSTVKHSTSSIG
SMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPR
IKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAP
PIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQ
CCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKESKESTVVKNLVDSSQKPAPA
AREDPAPKKSNSEPPARKPAEEKSEEGHAPTPAPEPKQATTPASRKSSKQLSQPAPAAPP
QPPTTGPARKEAPKTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDCEAENVWEMGGLGILTSVP
ITPRVVCFLCASSGHVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCGR
QHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDA
QWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGRCDRWVHSKCESLSDEMY
EILSNLPESVAYTCVNCTERHPAEWRLALEKELQLSLKQVLTALLNSRTTSHLLRYRQAA
KPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDEQQPLDLEGVKRKMDQGNYTSVLEFS
DDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSG
MLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPP
ILSTDRTREDSPELNPPPGIEDNRQCALCLMYGDDSANDAGRLLYIGQNEWTHVNCALWS
AEVFEDDDGSLKNVHMAVVRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFL
DDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIXXXX
XXXXEILNDLFDCEDKLFPIGYQCPXXXXXXXXXXXXXXXXXKIVECRPPVVEPDINSTV
QHDANRTIAHSPSSLTEISSKDSQNTAAILSPPSPERPPHVQTSSSCYYHVISKVPRIRT
PSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPLRSKL
RIVSPMRTGNTYSRNSVSSVSASGSAPDAEASAKVDHGLGPPSSSVNLGHGTPTSGRTVA
TIGTKASHLDGSSSSEMKHSSASDSASKSSSLKGEKTKMLSSKSSEGAAHVTHAAIPKLA
SQAHNTTSGELSVSKTGAFSEMSSVSFPSKEALPFAQLHLRGQRNDRDQHTESAQPANLS
PDEDIEVKTLKLSGVSNRSSIINEHVGSSSRDRRQKGKKSSKETFKEKHSSKSFLEPGQV
TTNEDGNLKPEFIDEVLTPEFMGQRPCNNISSEKIGDKGLSLSGVPKAVSMQVEESCKES
QAPRKCTVKVTPLKMESESQSKNALKESGPASPVQMESASPTDPVSASKSPGDGPVIQPS
PNNTSSQESQRNSYQNLPVQDRNLLLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPL
YGVRSYGEEDIPFYSSSPGKKRGKRSAEGQIDGADDLSTSDEDDLYYYNFTRTVISSGGE
ERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIAKRNGKENGTENLK
IDRPEDAGEKEHVTKSSVGHKSEPKMDNCHSVSRLKTQGQDSLEAQLSSLESSRRVHAST
PSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSEL
LNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVL
TTRSPTVPSQNPSRLAVISDSGEKRVAITEKSVASADGDPALLSPGVDPAPEGHMTPDHF
IQGHMDADHISSPPCGSVEQSHGTSQDLPRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSP
GPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSPVSSAPSV
METNSSVLGPMGSGLTLTTGLNPSLPASQSLFPPASKGLLSMPHHQHLHSFPAATQSSFP
PNISNPPSGLLIGVQPPPDPQLLVSEANQRTDLTTTVATPSSGLKKRPISRLHTRKNKKL
APSSTPSTIAPSDVVSNMTLINFTPSQLSSHPNLLDLGSLNTSSHRTVPNIIKRSKSGVM
YFEQAPLLPQSVSGTPAPATMSQDASHLATGPVSGLASSPSVLNVVSMQTSTTPTSSASV
PGHVTLTSPRLLGSSDGSISNLIASQQSLGIQQPVTLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXETEEHYQLQHVNQLLAGKGSLSQRDLDSASGTPAPNFT
QTADVPNSVRLEQSKALPPAAPASSTSPGGSPSSGQQSSSPSVPAPTKTKAKVKRIQLPL
DKGSGKKHKVSHSRTSSEAHVPDQEASTTSGPPVAGALGAETEQPDAVRMEQPAQKPLQK
ECGQPRGQVAVLPEAQATPNPTSEQENTEPKAVEEEESSFSSPLMLWLQQEQKRKESIAE
KKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGI
LHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLA
SKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRG
LFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAA
RFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAK
KCRKFLN
Download sequence
Identical sequences ENSDORP00000006787 ENSDORP00000006787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]