SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006857 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006857
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.33e-31
Family Galectin (animal S-lectin) 0.00000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006857   Gene: ENSDORG00000007312   Transcript: ENSDORT00000007312
Sequence length 100
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5722:612:2360:1 gene:ENSDORG00000007312 transcript:ENSDORT00000007312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTVPHKTSLPDGLRTGTVMRIRGIVPDKASRFHVNLLCSEDQGADAALHFNPRLDTSE
VVFNSMEQGKWGAEERGAGVPFQRGQPFEVLLITAEDGFK
Download sequence
Identical sequences ENSDORP00000006857 ENSDORP00000006857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]