SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006904 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006904
Domain Number 1 Region: 243-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-18
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 2 Region: 286-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000106
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 195-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000149
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006904   Gene: ENSDORG00000007361   Transcript: ENSDORT00000007360
Sequence length 618
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3500:31134:109775:-1 gene:ENSDORG00000007361 transcript:ENSDORT00000007360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVRTPLLTHCRAPPNTSLHTDLDLTGRDLTNPVPSCYILSSEPNSSLGSQLEAHLPES
GLKRCCLLGLPPTSSATSSSCTTSDVTPVMRSSQTALVTCINGLRSPSLPGDLGCPPKRA
RSSSVSTESHEGSLQLEACGKSGFLKQEPMDEFSELFAPHQQGLPPPYPLPQLSAGSGLG
GLGLGLAGRMVVGRQACRWVDCCXXXXQQEELVRHIEKSHIDQRKGEDFTCFWAGCVRRY
KPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQ
KAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQQVRKKLHAG
PETEADVLTECLALQQLHASTQLASSDGKGSLALGQELLPGVYPGSINPHSGLASGILPP
TLDVPSRPHPLDAASSHHHMSPLPTTESTRDGLGSSLLSPMVSPLKGLGPPPLPPSSQSQ
SPGGQPFPTLPSKPPYPPFQSPPPPPLPSPQGYQGSFHSIQNCFPYGDCYRTTEPATGGD
GLAGEAHGFNPLRPNGYHSLSAPLPAPGYEALVEAPCPTVLPPQPAEDVSSGPEDCSFFS
NGAFDHCLSHIPSIYTDT
Download sequence
Identical sequences ENSDORP00000006904 ENSDORP00000006904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]