SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007034 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007034
Domain Number 1 Region: 180-303
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 8.76e-60
Family Dystroglycan, domain 2 0.000000335
Further Details:      
 
Domain Number 2 Region: 61-159
Classification Level Classification E-value
Superfamily Cadherin-like 1.73e-18
Family Dystroglycan, N-terminal domain 0.00000243
Further Details:      
 
Domain Number 3 Region: 548-597
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000361
Family Dystroglycan, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007034   Gene: ENSDORG00000007501   Transcript: ENSDORT00000007500
Sequence length 893
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5448:515:11768:1 gene:ENSDORG00000007501 transcript:ENSDORT00000007500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKMSVGHSLLPLWGRTFLLLLFMAMAQSRWPSDPSEAVRDWENQLEASMHSVLSDLHEAV
PTVVGIPDGTAVVGRSFRVTIPTDLIASSGEIIKVSTAGKEALPSWLHWDPQSHTLEGLP
LDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHSEPQSVRAASPDPGDIVSSA
CAADEPVTVLTVILDADLTKMTPKQRLDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRSVEAPAREGAMSAQLGYPVVGWHIAN
KKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETLAPPVREP
VPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTMVPGQIRPTMTIPGYVELTAVITPPI
TTTKKPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLR
EQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQG
DKAPARFKAKFTGDPVPLVNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTN
NTLPLEPCPKEQITGLSRRIADDTGKPRPAFSNALEPDFKALSIAVTGAGSCQHLQFIPV
GSKKLPSTVPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGK
LTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPL
NQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSDORP00000007034 ENSDORP00000007034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]