SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007260 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007260
Domain Number 1 Region: 199-438
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-70
Family Nuclear receptor ligand-binding domain 0.000000000619
Further Details:      
 
Domain Number 2 Region: 88-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007260   Gene: ENSDORG00000007747   Transcript: ENSDORT00000007746
Sequence length 440
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2908:42938:52364:1 gene:ENSDORG00000007747 transcript:ENSDORT00000007746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWLEASGPVVSPDSAVELWEPDTQDASSQAQGGSTFLREDSRMPPSAGGPLGLRLEAE
ERTALLTEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVI
KGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQA
QTTSVPPRASSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPQSR
EARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYN
PGSESITFLKDFSYNREDFAKAGLQVEFINPIFDFSRAMNELQLNDAEFALLIAISIFSA
DRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFA
LRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences A0A1S3G9T5
XP_012885455.1.60039 ENSDORP00000007260 ENSDORP00000007260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]