SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007289 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007289
Domain Number 1 Region: 192-313
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.61e-49
Family Anticodon-binding domain of Class II aaRS 0.000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007289   Gene: ENSDORG00000007775   Transcript: ENSDORT00000007775
Sequence length 575
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1159:79165:97902:-1 gene:ENSDORG00000007775 transcript:ENSDORT00000007775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDRDIRDLRDHR
DSRDIRDHRDSRSMRDARDMRDLRGFRDLRDSRDFRDHRDPMYDRYRDIRDSRDPMYRRE
GSYDRYLRMDDYCRRKDDAYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQY
FEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALED
VSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREK
EREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKII
NYLRERKERLMRSSTDSLPGPISRQSLGATSGASLKTQPSSQPLQSSQVLPSATPTPTAP
PTSQQELQAKILSLFNSGTVVASSSSTSPSVVAGNTQNQNFSTAANSQPQPRSQASGSQP
PNILGQAGSARNMGPRPGAPTQGLFGQPSNRLTPASNMASQRPVSSTGINFDNPSVQKAL
DTLIQSGPALSHLVSQTAAQVGRPQAPMGSYQRHY
Download sequence
Identical sequences A0A1S3EQ54
ENSDORP00000007289 ENSDORP00000007289 XP_012866501.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]