SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007609 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000007609
Domain Number - Region: 153-177,298-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00031
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number - Region: 88-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00188
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 121-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0375
Family Classic zinc finger, C2H2 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007609   Gene: ENSDORG00000008110   Transcript: ENSDORT00000008109
Sequence length 365
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1015:79585:82275:-1 gene:ENSDORG00000008110 transcript:ENSDORT00000008109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKEQSGPSPDMLATAEPSSGETNKEVLPLDVAAGDSSSMEEEPGPDPAATLPVWDCGLQA
ASPVPGPGSVTSEDLRPPRRRPPAGKQIPCSSPGCCLSFPSVRELAQHLRTHCPPTQSLE
GKLFHCSAMSCSEIFPSMQELVAHGKLHYKPNRYFKCENCLLRFRTHRSLFKHLHVCAEH
AQSPAPPPPPSALDKEPPASDRASESDPASAPGLPFPLLEPFTTPASTGPFLPYLNPAPF
GVSPPRLRPFLAAAPGPPASSAAVWKKSQGAGGSPRRPQGGPDAPSGSAAPSRIVWEHTR
GRYSCMQCAFSTASRPAMTLHLRDHRPGALAAPGPQRPHAPEDPTPLAPKVSRMLWGVGG
RVPQL
Download sequence
Identical sequences ENSDORP00000007609 ENSDORP00000007609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]