SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007791 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007791
Domain Number 1 Region: 3412-3472
Classification Level Classification E-value
Superfamily SPOC domain-like 1.41e-19
Family SPOC domain 0.0000323
Further Details:      
 
Domain Number 2 Region: 341-455
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.3e-19
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007791   Gene: ENSDORG00000008297   Transcript: ENSDORT00000008301
Sequence length 3473
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_435:2232:30698:1 gene:ENSDORG00000008297 transcript:ENSDORT00000008301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASDNRERAYEHSAYGHHERGTGAFDRTRHYDQDYYRDPRERTLQHGLYYTSRSRSPNRFD
AHDPRYEPRAREQFTLPSVVHRDIYRDDLTREVRGRRPERNYQHSRSRSPHSSQSRNQSP
QRLASQASRPTRSPSGSGSRSRSSSSDSISSSSSTSSDXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIDIKKVNGVPQYAFLQYCDIASVCKAIKK
MDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMA
LVLYNEIEYAQAAVKETKGRKIGGNKIKVDFANRESQLAFYHCMEKSGQDIRDFYEMLTE
RREERRGSYDYNQDRTYYESVRTPGTYPEDSRRDYPARGREFYSEWETYQGDYYESRYYD
DPREYRDYRSDPYEQDIREYSYRQRERERERERFDSERDRDHERRPIERSQSPVHLRHPQ
SPGVSPSQSERLPSDSERRLYSRSSERSGSCSSLSPPRYDKLDKSRLERYTKNEKTDKER
IFDPERMERERRLTRKEKVEKDKPDKQRRKGKLHSPSSQSSETDQENEREQSPEKSRSSS
KLSREKTDKEGVGKNRLELMPCVVLTRVKEKEGKVIDHTPLEKLKARLDTDSAKSSVLQK
VASQTEPAKSDSKAPARGKVVRENVLSHMEVADKGRPKPRKPLPEQTSEGLSAVDLEKLE
ARKRFADSSLAERPPEVKSSPDMEDARVLKSQADWSSKKFILLAEGESRKPAKEILKRES
KKIKLDRLNTAPSPKDCQELASVSVGSGSRPSSDLQARLGEPGGESVENQESQSKKVTPS
KPQLKQLQLSDDQGPEREDGRKNCCSLREETSERKPGQEKPHVVNTEEKIGIDIDHTQSY
RKQMEQSRRKQQMEMEMAKSEKFGSPKKDIDEYEKRSLVHEVGKPPQDVTDDSPPSKKKR
MDHVDFDICTKRERNYRSSRQVSEDSERTGCSPSLRHSSFHEDDDPLGSPSLQVKGSHKA
DEKGLPYSNVTVREESLKFNPYDSSRREQMADMARIKLSVLNSEDELNRWDSQMKQDASR
FDVSFPNSIIKRDSLRKRCVRDLEPGEVPSDSDEDGEHKSHSPRASAVYENSRLSFLLRD
REDKPRDREERLSGSLERNKFYSFALDKTITPDTKALLERAKSLSSSREENWSFLDWDSR
FANFRNNKDKEKVDSAPRPIPSWYMKKKKIRTDSEGKMDDKKDDHKEEEQERQELFASRF
LHSSIFEQDSKRLQHLERKDEDSDLPPGRSYGRQVSDGPHTTSESVQEPVVLFHSKFMEL
TRMQQKEKEKDQKPKEVEKQDNTENHPKTPESAVENKESELKTLLPARLPSVPAVTAETA
SSMPEKTSERVAEASPVPLEEKPVEPAAVPEEIKPGAELAPVSGEQLEQVDVPPRADSGH
EAPAAPLTVQDNSPMDPPPSMDAKPPTPGPSLSQVESNVDPEPASPQLPSKPSQKTEDAE
EPKAERLDITSSIDPGINQKAEVAPEAQPQASEDAEIDPPTAAKDKKPNKSKRSKTPVQA
TAASIVEKPVTRKSERIDREKLKRSSSPRGEAQKLLELKMEAEKITRTASKHSSGDTEHP
EPSLPVSRTRRRNVRSVYATMSDHESRSPAKEPTEQLRVTRKRLERELQEAAVVPATPRR
GRPPKTRRRAEEDDEAETKEPAETPRPAEGWRSPRAQKAAGGQQGKRGRNEPKVEAERAE
AAAEARHQVNVKEGNTRSKGDKEEAGSDPKRDRKEMVTNKHVPDFEAMEKRPVPEKNSKS
KRGRSRNARGAVDRAAHLRSVAVAASPRGGQAVDREAGIVAISPEKSESPQKESRSSSQL
KTTPVDPDRESGREDLSAPRLSAEVAQLAKQMELERMELERAVENIAKLADTAPRGTYKA
AAMGAVGPTTEDRDKPAPQASETELAAAIGSIISDISDSPAPPPFPADSQTDLQSPGEAQ
PETHQAVSGIVEAALESSRPAVSAPVPSAAAKEAGGDGSDTSRLPRQARGSREGAVALVR
KDKGRQKTTRSRRRRNTNKKASAAAESRPPETDQAQGESPTVSEETTIQPPDSLQEDTQT
EKPQTTPPQACASDPTKTPPTEGLPEDSNAEEKTPPKVPTSPALPSLSQPVLADDEAQAR
FKVHSIIESDPVTPPSDSSLPLPILPSVTVAKLAAPVPSGAVPHQSPPTKLTEWITRQEE
PRPQSTPSPALPPDTKASDVDTSSSTLRKILMDPKYVSATGITSTSVTTAIPEPVSAAPA
LHTALPPPVEAKKPPVEESPVVPATQAADTQALQLPVTSDKEKVAPVIAPKITSVISRMP
VSIDLENSQKITLAKPAPQTLTGLVSALTGLVNVSLVPVNALKGPVKGSVATLKGLVSTP
AGPVNVLKGPVNVLTGPVNVLTTPVNATVGTVNTAAGAATVTAATXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXKEAAKTSECQAAPAPSALMRARIVTPSNQLRLPLTPPVVVTHGVQIVHSSGELF
QEYRYGDIRYHAPAQLSHTQFPVASSIGLPSRTKTPAQGPPEGEPLQPASPMSSAQPVPP
LPSCQPAPLSQPGQPPSSKKPQVSQEAKGTQTGGAEQPRLPAVPASRPSKPHAPLQRAQA
ETGPASHLSPVSVTMKPDLPALPPQAAPKQPLIIPTTTGPSTPPGLALPHAETQPAPSQD
SSPHLTSQRPVDMVQLLKEYPIVGLLALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVVSQTESKAITLQAKQAAGI
INVPNPGSNQPAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIASV
Download sequence
Identical sequences ENSDORP00000007791 ENSDORP00000007791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]