SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008238 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008238
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.94e-36
Family SCAN domain 0.0000378
Further Details:      
 
Domain Number 2 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 505-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 311-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.46e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 210-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000157
Family KRAB domain (Kruppel-associated box) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008238   Gene: ENSDORG00000008779   Transcript: ENSDORT00000008778
Sequence length 569
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_361:171908:177639:1 gene:ENSDORG00000008779 transcript:ENSDORT00000008778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATESRKPAAPSPPDQAPEEDLVIVKVEEDHGWDQESGLHESNPPGQELFRQRFRQLCYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQALVKEHQLENGE
EVVTLLEDLERQIDILGRPVPARAHGHRVLWEEIVSESSPRTHLQHMATQRKSPVPPKPQ
ESAMSTSQSPTPSQKGTSGKQEMTATLLTTGFQTLEKIEDMAVSLIQEEWLLDPNRDNRP
ENYRNMFSLGGETRNENKELASKQVISPGTQPHGETAAKCNGDVIGGLKQGEARDPLGRL
ERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFSYRSALLSHQ
DIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAGLILHQRIHS
GERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGHQRSHTGEKP
YKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIHTGEKPYQCN
ECGKAFIQRSSLIRHQRIHSGDKSETIGV
Download sequence
Identical sequences ENSDORP00000008238 ENSDORP00000008238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]