SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008260 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008260
Domain Number 1 Region: 322-597
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.3e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000014
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.46e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000853
Further Details:      
 
Domain Number 3 Region: 599-673
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.02e-20
Family Anticodon-binding domain of Class II aaRS 0.0033
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000131
Family TGS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008260   Gene: ENSDORG00000008801   Transcript: ENSDORT00000008802
Sequence length 674
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1863:47493:68665:1 gene:ENSDORG00000008801 transcript:ENSDORT00000008802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEKARNASGKMGGEEKRVDASEEKRKEGGKKKNKESCGDGGRAELNPWPEYINTRLEM
YNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQVACGISQGLADNTVIA
KVNKVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRIL
NEKVTTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMESLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKR
GFQEVVTPNIYNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSW
RELPLRVADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVY
NVFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQ
IKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTEN
YGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQL
AQYNFILVVGEKEK
Download sequence
Identical sequences ENSDORP00000008260 ENSDORP00000008260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]