SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008263 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008263
Domain Number 1 Region: 978-1037
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000311
Family BSTI 0.058
Further Details:      
 
Domain Number 2 Region: 594-652
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000036
Family BSTI 0.039
Further Details:      
 
Domain Number 3 Region: 1361-1420
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000131
Family ATI-like 0.018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000008263
Domain Number - Region: 2077-2118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00218
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 254-307
Classification Level Classification E-value
Superfamily FnI-like domain 0.00638
Family Fibronectin type I module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008263   Gene: ENSDORG00000008805   Transcript: ENSDORT00000008806
Sequence length 2147
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_719:22680:92647:-1 gene:ENSDORG00000008805 transcript:ENSDORT00000008806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYSSLLRIWVSFIFALVQHQVQPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPVLFFGV
PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFIAPFWADVHNGIRGEIYYRETMDPV
ILKRATKDIRKYFKDMPTFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTL
FNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRSPEIVNIQETTNVN
VPGRWAFKVDGKEIDPANGCTSRGQFLRRGEVFWDDLNCTIKCRCLDFNNEIYCQEASCS
PYELCEPKGKFFYCSPVETSTCVVFGEPHYHTFDGFLFHFKGSCAYLLARQCLQASSLPF
FSVEAKNEHRGSSAVSWVKELAIEVNGYKILIPKGSYGRVKVNDLVTSLPVTLDLGTVKI
YQSGMSTAVETDFGLLVTFDGQHYASISIPGSYINSTCGLCGNYNKNPLDDFLRPDGRPA
MSVLDLGESWRVYHADWKCGSGCVDNCTQCDATTEALYFGPDYCGFLNKTEGPLWECGTV
VDPTAFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRTQTGCVSTVRCPSF
SHYSVCTSSCPDTCSDLTASQNCATPCTEGCECNEGFVLSTSQCVPLHKCGCDFDGHYYT
MGEFFWATANCTVQCLCEEGGDVYCFNKTCRHGEVCAVEDGYQGCFPERETVCLLGQNQV
LRTFDGAAYAFPSEFSYTLLKTCPDRPDYLEIDINKKKPDAGPAWLRGLRILVADQEVKI
GGIGASEIKLNSQEVELPFFHPSGKLEIYRNRNSTTVESTVVTVQYSDAGLLYIRLSTAY
FNCTGGLCGFFNANASDEFCLPTGRCTDNLAVFLESWTTFEEICNGECGDLLKACNNDSE
LLKFYRSRSRCGIINDPSNSSFLECHAVVNVTAYYRTCLFRLCQSGGNESELCDSVARYA
GACKNADVEVGPWRTYDFCPLECPENSHFEECMTCTETCETLALGPICVDSCSEGCQCDE
GYALQGSQCVARSECGCSFEGHQLATNETFWVDQDCQIFCYCNGTDNSVHCETLPCRDDE
FCMEEGGLYGCRARTDASCIISGYDHYLTDGPFDQSSCPLILCNTGNRPSSDTFPKFIVT
AKNEDRDPSLALWVKQVDVTVFGYSIVILRAYKHTVLVNGERLYLPLKLGQGKINIFSFG
FHVVVETDFGLKVVYDWKTFLSITIPRSMQNGTYGLCGRYNGNPDDDLEMPMGLPALSIH
EFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCSLIPSQSAGFAKCHSKVNPTFFY
KNCLFDSCIDGGAVQTACGWLQNYASTCQTGIAVTGWRYSCSVTCPPNSHYESCVSVCQP
RCAAIRLKSDCNHYCVEGCQCDAGYVLNGKSCILPHSCGCYADGKYYEPKQLFWNSDCTR
RCRCFRRNLIQCDPRQCKSEECALRHGARSCFSTRSSFCLTAGSGVFRTFDDAFLRFPAN
CAFVLSTICQKLPDVSFQLIINFDKWSSPNLTVISPVYFYINEEQILISDRNTVKVNGTQ
VNVPFVTGLATKIYSSEGFLVIDTSPDIRIHYNGYNVIKISISERLQNKVCGLCGNFNGD
LTDDYVTLRGKPVXXXXXXXXXXXXXXXXXXPLTPSCNELQFSQYAATCDNVHIQAMQGE
GYCLKLTDMKGVFQPCYGLLDPLPFYESCYLDGCYNLKKFQLCGSLAAYGEACRSFGILS
TEWIEKENCSGVVEDPCVGADCPNRTCELENGRELCGCIEPPPYGNNSHDIIDAEVTCKA
AQMEVSISKCKLFQLGFEREGVRVNDRQCSGIEGEDFISFQINNTKGNCGNIVQSNGTHI
MYKNTIWIESANNTGNIITRDRTISVDFSCAYELDIKISLDSVVKPMLSVINLTVPTQEG
SFTTKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADSTHLILTLNKCYATPSRDS
NDKLRYFIIEGGCQNIKDNTIGIEENGVSLTCRFHVTVFKFIGDYDEVHLHCAVSLCDSE
KYSCKINCPQNSRIAKDYAKEPKEQIISVGPIRRKRLDWCEDNGGCEQICTSRVDGPLCS
CVTGTLQEDGRSCRASNSSIELQVWTILLIVTQISLWHFVYTSRLTS
Download sequence
Identical sequences ENSDORP00000008263 ENSDORP00000008263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]