SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008391 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008391
Domain Number 1 Region: 17-107
Classification Level Classification E-value
Superfamily RING/U-box 8.25e-31
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 2 Region: 107-171
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.26e-18
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008391   Gene: ENSDORG00000008938   Transcript: ENSDORT00000008938
Sequence length 671
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2274:2168:22127:1 gene:ENSDORG00000008938 transcript:ENSDORT00000008938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILARTILEFKGQAARKVAAMSSAVLVDIQEEVTCPICLELLTEPLSIDCGHSFCKACITR
NSEESVRHREEKSSCPVCKASYQPGSLRPNRHLANIVKRLREVVLGPGKQAKVILCAQHG
EKLQLFCKEDGELICWLCERSQEHRGHHTFLMEEVAQEYQEMFQESLKKLRKEQQEAERL
IAVIRENRTSWKSQMEPERHRIQKEFNKLRNIPDREEQQELKKLEEEETKGLGIMQTAQG
ELIPPNPSLRELISDLERRCQGSTVDLLQDVSDVTKRNEFWTLREPLALPTKLRSKFRAP
DLKRMLRVFRELTDVQSYWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLTSQPAYPYFNPDS
PAPMTLGPPAF
Download sequence
Identical sequences ENSDORP00000008391 ENSDORP00000008391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]