SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008466 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000008466
Domain Number - Region: 200-223
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0868
Family C-type lectin domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008466   Gene: ENSDORG00000009017   Transcript: ENSDORT00000009017
Sequence length 223
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3871:79387:82729:-1 gene:ENSDORG00000009017 transcript:ENSDORT00000009017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLLALLVGAVSALHLSADTPNSKSPLEDKSLTREEEWPTQEVEDLLSGELMELEEAE
GSGSKEISEEEGAVQPVSALDIANNSFQCPAKENTVELLGIPGCKTCHYILVTAAATFSE
ARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSVSMCVQGGRWRTSHCCKRLPFVCSR
Download sequence
Identical sequences ENSDORP00000008466 ENSDORP00000008466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]