SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008533 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008533
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-25
Family DEATH effector domain, DED 0.0000258
Further Details:      
 
Domain Number 2 Region: 125-190
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000289
Family DEATH domain, DD 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008533   Gene: ENSDORG00000009086   Transcript: ENSDORT00000009085
Sequence length 207
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2721:58571:61157:1 gene:ENSDORG00000009086 transcript:ENSDORT00000009085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFLVLLHSVSTGLSSAELTELKFLCLGRVGKRKLERVQSGLDLFTVLLEQSDLEPGRL
GLLRELLGSLRRHDLLRRLDDFEAGAAAGAAPGAAXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXRIDGIEERYPRSLMERVRESLRIWKDAEREKATVERLVEALRACQMNLVADLVEEE
QQAGIQKGSEAVSSMSWDDMSTMEGPW
Download sequence
Identical sequences ENSDORP00000008533 ENSDORP00000008533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]