SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008598 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008598
Domain Number 1 Region: 168-432
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-87
Family Nuclear receptor ligand-binding domain 0.000000000192
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000989
Family Nuclear receptor 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008598   Gene: ENSDORG00000009154   Transcript: ENSDORT00000009154
Sequence length 433
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1772:8648:19422:1 gene:ENSDORG00000009154 transcript:ENSDORT00000009154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPQEAAPEVREEEEKEEEAAAEGAPLPSSSSCTDLSQSASPPSLLDQLQMGCDGASGG
GLNMECRVCGDKASGFHYGVHACEGCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXIRFGRMPEAEKRKLVAGLTASEGHQHNPQLADLKAFSKHIYNAYLK
NFNMTKKKARSILTGKSSHTAPFVIHDIETLWQAEKGLVWKQLVNSLPPYKEISVHVFYR
CQCTTVETVRELTEFAKSIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANG
SGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVP
QVEAIQDTILRALEFHLQANHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLKKTETETL
LHPLLQEIYKDMY
Download sequence
Identical sequences ENSDORP00000008598 ENSDORP00000008598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]