SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008900 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008900
Domain Number 1 Region: 113-243
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.38e-32
Family Ankyrin repeat 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008900   Gene: ENSDORG00000009476   Transcript: ENSDORT00000009476
Sequence length 298
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1065:29443:38878:-1 gene:ENSDORG00000009476 transcript:ENSDORT00000009476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAGGAGDEPRSGGSSSDGECAVAPEPLAEAEGLFSFADLGSALVGGAGLPGRASGGS
ESPLRFLHVLWQQNAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANAN
DVETVQQLLDDGTDPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPLH
LAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNIQEGHSQCLEAVRLEVKQII
HMLREYLERLGQHEQRDRLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQNMEKR
Download sequence
Identical sequences ENSDORP00000008900 ENSDORP00000008900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]