SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009110 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009110
Domain Number 1 Region: 130-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000879
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009110
Domain Number - Region: 165-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000106
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009110   Gene: ENSDORG00000009693   Transcript: ENSDORT00000009693
Sequence length 188
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6553:90383:113040:-1 gene:ENSDORG00000009693 transcript:ENSDORT00000009693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAYMDFVAAQCLVSISNRAAVPEHGGVPDPEREGTKEHGDPGDTWKDYCTLVTIAKS
LLDLNKYRPIQTPSVCSDSLESPDDDLGSDSDVTTESGSSPSHSPEERQDSGSAPSPLSL
LHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSR
SDELTRHY
Download sequence
Identical sequences ENSDORP00000009110 ENSDORP00000009110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]