SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009134 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009134
Domain Number 1 Region: 4-553
Classification Level Classification E-value
Superfamily SIS domain 1.53e-231
Family Phosphoglucose isomerase, PGI 0.00000000000000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009134   Gene: ENSDORG00000009716   Transcript: ENSDORT00000009717
Sequence length 558
Comment pep:novel scaffold:dipOrd1:scaffold_16214:7131:29800:-1 gene:ENSDORG00000009716 transcript:ENSDORT00000009717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTQNPDFQKLRQWHKDHHGSLNLRELFQGDKDRFNKFSLTLNTNHGHILLDYSKNLV
TEEVMKMLVNLAKSRGVEAAREHMFTGEKINYTEDRAVLHVALRNRSNNPIMVDGKDVMP
EVNKVLEKMKTFCQRVRSGEWKGYTGKAITDVINIGIGGSDLGPLMVTEALKTYSSGGPR
VWFVSNIDGTHIAKTLANLNPETSLFIIASKTFTTQETITNAETAKEWFLSSAKDTSTVA
KHFVALSTNTSKVKDFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHIGFENFEQLLSGA
HWMDQHFRKTPLEKNAPVLLALLGIWYINCYGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGARVDHQTGSIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPAQTQHPIRKGL
HHKILLANFLAQTEALMKGKSTEEARKELQAAGKSSEAIEKLLPHKVFEGNRPTNSIVFT
RLTPFILGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDSNNPVTSHDS
STNGLISFIKEQREVKLE
Download sequence
Identical sequences ENSDORP00000009134 ENSDORP00000009134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]