SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009196 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009196
Domain Number 1 Region: 180-451
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-76
Family Nuclear receptor ligand-binding domain 0.00000000669
Further Details:      
 
Domain Number 2 Region: 127-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.48e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009196   Gene: ENSDORG00000009780   Transcript: ENSDORT00000009780
Sequence length 457
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_2920:13456:39736:1 gene:ENSDORG00000009780 transcript:ENSDORT00000009780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSTQVNSSSLNSPTGRGSMAAPSLHPSLGPGLGSPLGSPGQLHSPISTLSSPINGMGPPF
SVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPAHPSG
NMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRN
RCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPK
TETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRVPHFSELPLDDQVILLRAGW
NELLIASFSHRSITVKGGILLAXXXXXXXXXXXXXXXXXXXXXVLTELVSKMRDMQMDKT
ELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPAL
RSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences ENSDORP00000009196 ENSDORP00000009196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]