SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009401 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009401
Domain Number 1 Region: 532-777
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-59
Family Nuclear receptor ligand-binding domain 0.000000000466
Further Details:      
 
Domain Number 2 Region: 420-503
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-25
Family Nuclear receptor 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009401   Gene: ENSDORG00000010001   Transcript: ENSDORT00000010001
Sequence length 778
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1872:6346:65929:-1 gene:ENSDORG00000010001 transcript:ENSDORT00000010001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKESLAPPSKEVPSSVLGSDRGNVMDFYKTLRGGATVKVSASSPSLATASPTDSKQQR
HLVDFPKGSANNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDFR
LLEESIANLNKSTSVPENPKSSASASVSAAPSEKEFPKTHPGVCSEQLNLKSQPGTNGTN
GGNVKLYTTDQSTFDILQDLEFPPGSPGKETNESPWRSDLLIDENCLLSPLAGEDDPFPL
EGDVSEDCKPLILPDTKPKIKDNGDIILSSPSSVPLPQVKTEKEDFIELCTPGVIKQEKL
GPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASISQQQDQKPIFNVIPPI
PVGSENWNRCQGSGDDNLTSLGTMNFPGRSVFSNGYSSPGMRPDVSSPPSSSSTATGPPP
KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACR
YRKCLQAGMNLEARKTKKKIKGIQQATTGVPQDTSENPNKTIVPATLPQLTPTLVSLLEV
IEPEVLYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQY
SWMFLMAFALGWRSYRQTSANLLCFAPDLIIDEQRMSLPCMYDQCKHMLFVSSELQRLQV
SYEEYLCMKTLLLLSTVPKEGLKSQELFDEIRMYIKELGKAIVKREGNSSQNWQRFYQLT
KLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
Download sequence
Identical sequences ENSDORP00000009401 ENSDORP00000009401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]