SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009548 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009548
Domain Number 1 Region: 604-723
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-28
Family Nuclear receptor ligand-binding domain 0.00000284
Further Details:      
 
Domain Number 2 Region: 515-592
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-25
Family Nuclear receptor 0.0000166
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009548
Domain Number - Region: 820-868
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00335
Family Nuclear receptor ligand-binding domain 0.0000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009548   Gene: ENSDORG00000010157   Transcript: ENSDORT00000010157
Sequence length 870
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5152:21865:200054:1 gene:ENSDORG00000010157 transcript:ENSDORT00000010157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRQPEAAGTAPPGSRLQQQETS
PRRQQQHGEDGSPQSHLRGPTSYLALDEEQQPSQQHSAPEGHPESSCLSEPGAATATGKG
LPQQPPEPPDENDSAAPSTMSLLGPTFPGLTSCSADLKDILSEAGTMQLLQQQQQEGVSE
GNSSGRAREAAGASSSSKDSYGGNSTISDSAKELCKAVSVSMGLGVEALEHLSPGEQLRG
DCMYAPLLGGPPAVRPSPCAPLAECKGPLLDEGPGKGTEETAEYSSFKGGYAKGLDGESL
SCSGSSEAGNSGTLELPSTLSLYKPGALEEGAPYPNRDYYNFPLALPGPPPPPHPHARIK
LENPLDYSSAWAAAAAQCRYGDLANLHGAGTAGPSSGSPSTSTSSSWHTLFAADEGQIYG
PCGGSGSGSAGEAGTVAPYGYPRPPQGLASQEGDYSGPDVWYPSGVVSRMPYPSPSCVKS
EMGPWMESYSGHYGDMRLESARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKV
FFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQE
EGESSSASSPTEDPSQKMTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALL
SSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRM
LYFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIARELHQFTFDLLIKSHMVSV
DFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences ENSDORP00000009548 ENSDORP00000009548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]