SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010225 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010225
Domain Number 1 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 308-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 504-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000392
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 8 Region: 172-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000365
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 118-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000136
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010225   Gene: ENSDORG00000010879   Transcript: ENSDORT00000010879
Sequence length 565
Comment pep:novel scaffold:dipOrd1:scaffold_42044:2871:5491:1 gene:ENSDORG00000010879 transcript:ENSDORT00000010879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSLWTPCLISQWEQEEDLQSMKRGLIQDTCPLEDHKGFETQLKTDELVLQATEVEKLSKE
QEIVGLKRNDSWSSASQENWGSQDSDCQNKSQETPLRSHVVGRVYCNEEIAGQGVSSYRC
HQCGKAFTFHSSLKNHLRSHAGSKPYQCKECGKAFHFLACFKKHLKTPIEEKPYECQECS
RTFSCSSLFRAHMKIHSDKGNYECEECGHVFSSFSYLTEHKRIHNGEKPYECKECGKAFS
CSSSLSKHKRIHSGDKPYECKECGKAFSSSSHLIIHIRIHTGEKPYECKECGKAFSESSK
LTVHARVHTGEKPYKCEECGKAYNCPSSLSIHMRKHTGEKPYECFECGKAFYLPTSLNTH
VKNQSREKPSECKDCGKAFSCPSSYKAHVRDHMGKVQYECKECGKAFNRSSSLTEHLRTH
SGEKPYECTECGKAFISSSHLTVHRRTHTGEKPYECQKCGKAFIYFSALSIHMRTHTGEK
PYECKACGKAFRHSSYLTVHARMHTGEKPFECLECGRAFSCPSSFRRHVRSHTGEKPYEC
KECGKAFICPAYFRRHLKIHTRENT
Download sequence
Identical sequences ENSDORP00000010225 ENSDORP00000010225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]