SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010240 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010240
Domain Number 1 Region: 304-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000324
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 2 Region: 462-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000899
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 423-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000188
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 381-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 344-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 6 Region: 265-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000004
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010240   Gene: ENSDORG00000010893   Transcript: ENSDORT00000010895
Sequence length 665
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2579:19044:30170:1 gene:ENSDORG00000010893 transcript:ENSDORT00000010895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAGQRGVFQLQLLEFANERGVLASGRPCEPGCRTFFRVCLKHFQAVVSYGHCTFGNVST
PVLGTNSFAIRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEAPPPDSLIS
QISIQRSLTVGQNWLRDEQTSTLPLTKLSYSYRVICSDNYYGENCSRLCKKRNDRFGHYV
CQPDGSLSCLPGWTGEYCDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXLNYCTHSPCKNGATCSNSGQRSYTCTCAPGYTGVDC
ELELRECDSNPCRNGGSCEDQRDGYHCLCPPGYYGLHCEHSTLTCADSPCFNGGSCREHN
QGASYACECPPTFTGSNCEKKVDRCTNNPCANGGQCLNRGPTRMCRCRPGFTGPHCELSV
GGDCSHSPCANGGTCHHLENGPVCTCPAGFSGRRCEVRTAGDACASGPCFNGATCYAGLS
LDSFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLVVVLVLLGMVAVAVRQLRLRRP
DDSSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGKHQNHTLDYNLAPG
HLGRGTLPGKYPHSEKSLGEKVPLRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXV
Download sequence
Identical sequences ENSDORP00000010240 ENSDORP00000010240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]