SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010440 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010440
Domain Number 1 Region: 542-667
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-19
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 82-266
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000239
Family Clathrin adaptor core protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010440   Gene: ENSDORG00000011109   Transcript: ENSDORT00000011110
Sequence length 721
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_8778:11787:40433:-1 gene:ENSDORG00000011109 transcript:ENSDORT00000011110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLY
ITEQTRNDIKNGTILQLAVSPSRAARQLMERTQSSNMEARLEAMKELAKLSADVTFATEF
INMDGIAVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALIN
ALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYVLQVLTFNLLEER
MMTKMDPNDQAQRDIIFELRRIAFDAESDPSSVPGSGTEKRKAMYTKDYKMLGFTNHVNP
ALDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSILRLRQSERMSQDDFQSPPIVELREKIQPEILE
LIKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQE
KIPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLNFIAPNKYEYCIWI
DGLSALLGKDMSSELTKSDLDMLLSMEMKLRLLDLENIQIPEAPPPVPKEPSSYDFVYHY
S
Download sequence
Identical sequences ENSDORP00000010440 ENSDORP00000010440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]