SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010533 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010533
Domain Number 1 Region: 522-595
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000772
Family Ricin B-like 0.0086
Further Details:      
 
Domain Number 2 Region: 130-195
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000000315
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 360-455
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000000675
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010533   Gene: ENSDORG00000011211   Transcript: ENSDORT00000011211
Sequence length 597
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6043:22679:92808:1 gene:ENSDORG00000011211 transcript:ENSDORT00000011211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLRRVKVLLVLNLAAVAGFVLFVARYQPIAVRDGDAFHELRTRAEAANLSAPARPVQD
AVIRRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYN
SFLSEKISLDRSIPDYRPTKCKELKYAKELPQISIIFIFVNEALSVILRSVHSAVNHTPT
HLLKEVILVDDNSDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXAEPVLSRIQENGKRVILPSIDNIKQDTFEVQRYENSAHGYSWELWC
MYISPPKDWWDAGDPSLPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
WLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPL
ENPGIDIGDVSERRALRKSLKCKSFQWYLDHVYPEMRRYNNTVAYGEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLARYTKEGLLHLGALGTTTLLPDTRCLVDSAKSRLPQLLDC
DKVKSSLHKRWAFIQNGAIMNKGTGRCLEVENRGLSGLDLILRPCTGQRWTIKNYIK
Download sequence
Identical sequences ENSDORP00000010533 ENSDORP00000010533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]