SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010985 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010985
Domain Number 1 Region: 744-885
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-58
Family Sec7 domain 0.00000652
Further Details:      
 
Domain Number 2 Region: 1138-1529
Classification Level Classification E-value
Superfamily ARM repeat 1.38e-20
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010985   Gene: ENSDORG00000011683   Transcript: ENSDORT00000011687
Sequence length 1847
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_460:2492:99542:-1 gene:ENSDORG00000011683 transcript:ENSDORT00000011687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVAFDEIKAETEKQSPPHGEAKV
GSSTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDCLQXXXXXXXXXXXXXDST
TPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQMEKERHRQHHHLLQSPVSHHQ
PESPQLRYLPPQTIDHISQEHEDLDPHTNDVDKSLHDDTEPENGSDISSAENEQTEADQA
TAAETLSKNDVLYDGENHDCEEKPQDIVQSIVEEMVNIIVGEMGEGTTINANTDGNIGAI
EDGSDSENIQANGIPGTPISVAYTPSLDDRLSVSSNDTQESGNSSGPSPGAKFSHILQKD
AFLVFRSLCKLSMKPLSDGPPDPXXXXXXXXXXXXXXXXXXLQNAGPVFRTNEMFINAIK
QYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEKPSEQEMSEMKHPETINRY
GSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALR
MFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQ
VKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSTKQNVA
SEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSV
GLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKN
IDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSLTG
TKDQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVD
FVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNP
NEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQ
MVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTLVFEKHFPATIDSFQD
AVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSERPQAFKEYTSDDMNVAPEDRVWVRGW
FPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPE
QQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSGTN
CLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPTSGETSLPPQSPVSEKQL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPEQKLFAALLIKCV
VQLELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVRVDTQDQGMYRFLTSQQLFKL
LDCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYMDES
RVSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDNRFKAHASF
YYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPPEQELGINKP
Download sequence
Identical sequences ENSDORP00000010985 ENSDORP00000010985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]