SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011001 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011001
Domain Number 1 Region: 472-754
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-58
Family Eukaryotic proteases 0.00000000034
Further Details:      
 
Domain Number 2 Region: 240-470
Classification Level Classification E-value
Superfamily vWA-like 3.71e-52
Family Integrin A (or I) domain 0.00000000425
Further Details:      
 
Domain Number 3 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000181
Family Complement control module/SCR domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011001   Gene: ENSDORG00000011702   Transcript: ENSDORT00000011703
Sequence length 760
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6608:15051:22251:1 gene:ENSDORG00000011702 transcript:ENSDORT00000011703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHNPSSQLWLVSLFLAFSCGGVSTTPSPVDQAQSSCSLEGVEIKGGSFQLLQEGQTLEY
LCPSGFYPYPVQTRTCKATGSWSTLKTRDQKIVKKAECRXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFMYDTPEEVAEAFLSSLTE
TIEGVDAEDGHRPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLTNLIEKV
ASYGVRPRYALVTYATAPKIVVKVSDEKSSDADWVTEQLKISYDHKLKSGTNTKRALQTV
YSMMSWAGDVPPEGWNRTRHVIILMTDGLHNMGGDPVTVIDEIRSWLDIGRDRKNPREDY
LDVYVFGVGPLVDQDNINALASKKENEQHVFRVKDMENLEDVFYQMIDETKSLGLCGMVW
EHRKGTDYHKQPWQAKISVTRPLKGHENCMGAVVSEYFVLTAAHCFTVDDEKHSIKVSVG
GRKRDLEVEEVLFHPNYNINGKTAQGIPEFYDYDVALIKLKKRLTYDQTVRPICLPCTEG
TTRALRLPQTATCQQHKEELLPAKDIKALFVSEEEKKLTRKHVFIKNGDKKASCERDAQN
APGYDKVKDISEVVTPRFLCTGGVDPYADPNTCRGDSGGPLIIHKRSRFIQVGVISWGVV
DVCKHQKKQVPAHARDFHVNLFQVLPWLKEKLKDEDLGFL
Download sequence
Identical sequences ENSDORP00000011001 ENSDORP00000011001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]