SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011243 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011243
Domain Number 1 Region: 134-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000251
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 92-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011243   Gene: ENSDORG00000011957   Transcript: ENSDORT00000011962
Sequence length 410
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2896:111027:226949:-1 gene:ENSDORG00000011957 transcript:ENSDORT00000011962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVPPPPPPSRGGAAGGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSENKIATTKY
PCLKSSGELTTCFRKKCCKGYKFVLGQCIPEDYDVCAQAPCEQQCTDNFGRVLCTCYPGY
RYDRERHRKREKPYCLDIDECAASNQTLCAHVCTNTVGSYRCECREGFILEDDGKTCTRG
DKYPNDTGHEEKSENAVKAGTCCATCKEFHQMKQTVLQLKQKIALLPNNAAELGKYVTGD
KVLASNTYLPGPPGLPGGQGPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGERGAPGPRGSPGPPGSFDFLLLMLADIRNDIAELQEQV
FGHRTHSSAEEFPSPQEFSSYPETMDFGSGDDYPRGTEARDLGGPRDLYP
Download sequence
Identical sequences ENSDORP00000011243 ENSDORP00000011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]