SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011413 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011413
Domain Number 1 Region: 103-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 765-835
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000184
Family Homeodomain 0.00045
Further Details:      
 
Domain Number 3 Region: 498-554
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000471
Family Homeodomain 0.0069
Further Details:      
 
Domain Number 4 Region: 613-668
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000188
Family Homeodomain 0.0009
Further Details:      
 
Domain Number 5 Region: 316-371
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000642
Family Homeodomain 0.01
Further Details:      
 
Domain Number 6 Region: 847-888
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000133
Family Homeodomain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011413
Domain Number - Region: 77-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0278
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011413   Gene: ENSDORG00000012139   Transcript: ENSDORT00000012138
Sequence length 950
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6554:175191:183399:-1 gene:ENSDORG00000012139 transcript:ENSDORT00000012138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTIPCMIPVKTVVLQGASVEAQPVEALSAGPQQDLPPEAPASSSEAAQNPSSTD
CSALANGHRSSLDGYLYSCKDCEFRSQDITQFVGHMNSEHTDFNKDPHFICTGCSFLAKT
PEGLSLHNAKCHSGEASFVWSVAKLDNHVVVEQSVPEGTSTPDVAGEASTEGTDGQAEII
ITKTPIMKIMKSKAEAKKIHMFKENVPSQPGSEALPKPAAAETEVKEGDHAFLNGAAPAN
QAPTSSTKPPHAANGPLIGTVPVLPAGIAQFLSLQQQQPSVHAQHHTHQSLPTSKALPKV
MIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQRLKQ
GISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQHLIQAALPGHVVGQPE
GTAGGLLVTQPLMANGLQAPSSSLPLTATSVPKPNATPINTVCSNTTSAVKVVNAAQSLL
TACPSITSQAFLDASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRK
WFSDRRYHCRNLKGSRAMMPGEHSSLLIDSVPEIPFSLSSKAPDVTCLPTAASLASHPAA
KRQSWHQTPDFTPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWF
SERRKKVSAEDSKKGDAEHAPWEDEEPAEEEGGEGNSASELRVPGENGSPEVLLSQTSAE
RKVSPIKINLKNLRVTEASGKSELPGLSACEPEEDVLSKLTEQPPGKVSYKKTAQQRHLL
RQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGL
LVIAPGNRELLQDYYVTHKMLYEEDLQNLCDKTHMSSQQVKQWFAEKMGEETRAVADTSS
EDQGPGPGEPAAVHRRLEVPENSESWEPSAPDASSEPPSSPQSGLPLETD
Download sequence
Identical sequences ENSDORP00000011413 ENSDORP00000011413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]