SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011810 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011810
Domain Number 1 Region: 50-221
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.42e-69
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000174
Further Details:      
 
Domain Number 2 Region: 216-348
Classification Level Classification E-value
Superfamily E set domains 2.57e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011810   Gene: ENSDORG00000012560   Transcript: ENSDORT00000012560
Sequence length 436
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5452:94073:103043:-1 gene:ENSDORG00000012560 transcript:ENSDORT00000012560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGEWLRSSARRGLSCDPGPAPGTPAMDXXXXXXXXXXXXXXXXXXXXXXXQPKQRGMRFR
YKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDC
HDGFYEAELCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLN
AVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLL
CDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRP
SDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPSPRRIAVPS
RNSTVPKPAPQPYAFPPSLSTINFDEFSPMLLPSGQIPNQASALAPAPTQVLAQTLAPTS
AMASALGAPAPVPSLP
Download sequence
Identical sequences ENSDORP00000011810 ENSDORP00000011810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]