SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011819 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011819
Domain Number 1 Region: 257-392
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 3-127
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.38e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 172-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000104
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 131-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000188
Family EGF-type module 0.02
Further Details:      
 
Domain Number 5 Region: 574-683
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000113
Family Growth factor receptor domain 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011819
Domain Number - Region: 824-869
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000115
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011819   Gene: ENSDORG00000012568   Transcript: ENSDORT00000012569
Sequence length 948
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5559:1050:68004:-1 gene:ENSDORG00000012568 transcript:ENSDORT00000012569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDECAQGLDDCHADALCQNTPSSYKCSCKPGYQGEGRQCEDIDECENEFNGGCVHDCLNI
PGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECRCKEGFFLSDNQH
TCIHRLEEGLSCMNKDHGCSHICKEAPKGSVACECRPGFELAKNQRDCILTCNHGNGGCQ
HSCEDTAEGPECSCHPGYKLHTDGRSCLEREDTAPEVTESNATLVADGDKRVKRRLLMET
CAVNGGCDRTDTTGVHCSVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNTVGSFDCGCKK
GFKLLTDEKSCQDVDECSLDRTCDHSCINHQGTFACACNLGYTLYGFTHCGDTNECSINN
GGCQQVCVNTVGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPHVSLHCSKSGGGDRCF
LRCHSGIHLSSDVATIRTSVTFKLNEGKCSLKKAELFPEGLRPVLPEKHSSVKESFRYAN
LTCISSKQLPGTPGRLSAPKDMFITVEFERETYPKEVTASCDLSCLVKRTEKRLRKAIRT
LRKAAHRDQLHLQLSGMDLDVAKKSPRTSEQRAESCGGDQGHAENQCVNCRAGTYNDGAQ
ERCILCPNGTFQNEEGQLTCEPCPKPENPGALKSSEAWNVSECGGLYQPGEYSADGFAPC
QPCALGTFQPDAGRTSCFPCGGGLPTKQLGAISFQDCETRXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSNSVTTYETCQTYERPIA
FTSRSKKLWIQFKSNEGNSARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDK
KLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSDORP00000011819 ENSDORP00000011819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]