SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012382 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012382
Domain Number 1 Region: 633-828
Classification Level Classification E-value
Superfamily Sec7 domain 2.88e-53
Family Sec7 domain 0.000011
Further Details:      
 
Domain Number 2 Region: 402-579,1088-1254,1302-1464
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000014
Family Armadillo repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012382   Gene: ENSDORG00000013169   Transcript: ENSDORT00000013169
Sequence length 1778
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2397:3876:65630:1 gene:ENSDORG00000013169 transcript:ENSDORT00000013169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEAKRPQHSQLRRACQVALXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPIQSKPQSPVIQAAAGSPKLNRLKQSQAQS
KPTTPEKTDLPNGEHARSDTGKVSSENGDTPGERGPSLPXXXXXXXXXXXXXXXXXXXXX
XXXAAEKHGLAEPDRVLSELECQECPVLPGVDENSQTNGIADDRQSLSSADNLSDVQGHP
VAARFSHVLQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLSVLQNAGPV
FRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKEI
FLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIA
QGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQERLTDQEV
GDGKGLDMARRCSVTSMESTVSSGTQTTIQDDPEQFEVIKQQKEIIEHGIELFNKKPKRG
IQFLQEQGMLGASVEDIAQFLHQEERLDSTQVGDFLGDGARLNKEVMYAYVDQLDFCEKE
FVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKEHSIATKS
TKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILKCISQLELAQLIGTGVKTRYLSGSGRER
EGSLKGHTLAGEEFMGLGLGNLVSGGVDRRQMASFQESVGETSSQSVVVAVDRIFTGSTR
LDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHVIGDH
FNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRD
MVIRCIAQMVSSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLQEYTSDDMNVAPG
DRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVFRI
FDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCVKQDNE
QLARSGTNCLENLVISNEKFSPEVWDETCCMDIFTTIPHLLMWKAGMDEEPFEKHLXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKLFASLLIKCVVQLELIQTIDNIV
FYPATSKKEDAEHMVAAQQDTLEAEIHIETEDQGMYKHMSSQHLFKLLDCLQESHSFSKA
FNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMXXXXXXXXXXXXXXXXXX
XVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASMYYPYLCEIMQFDL
IPELRAVLRKFFLRIGIVYKIWIPEELSQAPAALSSVW
Download sequence
Identical sequences ENSDORP00000012382 ENSDORP00000012382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]