SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012445 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012445
Domain Number 1 Region: 180-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000437
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 2 Region: 46-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 3-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000507
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 146-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000919
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012445
Domain Number - Region: 642-704
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0298
Family Biotin holoenzyme synthetase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012445   Gene: ENSDORG00000013236   Transcript: ENSDORT00000013236
Sequence length 711
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5527:1353:27465:1 gene:ENSDORG00000013236 transcript:ENSDORT00000013236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INECVESPDPCGPHSICSNLLGRYTCSCVSGFSSPTGNNWAPGKPGTFSCADIDECVASR
ICPEHAHCTNTMGSYRCICQAGFIARGSTCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTDACDRCPANATCTNTPGGHFCTCHAGFTPSSGQQNFTD
QEVQCTDIDECSQDPELCGPNSVCANALGSYRCGCRVGFRANPGGSQAHGNFSCEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQVESFS
SVLQESPMWRNLSQPEVSALASVLLASVESSTLASLLTLSANNSQTIQTEYLDIESRIIN
EECNRDMSIQLKAKGDGIKIGCSTIEESGPTGPAGVAFVSFASLESVLDTRFFGDPSVGG
AGAKVTLRMSSRVVGAIVTGEKKAGLADPVIYTXXXXXPKQKSERPICVTWSTDTEEGRW
TPAGCVILEASERRTVCSCHQMANLAIIMASGELTXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGCAIIAGVLHYLFLAAFSW
MLVEAVMLFLTVRNLKVVNYFSSRDVRMLYLCAFGYGFPGLVVAVSAGMQPQGYGMHNRC
WLNTETGFIWSFLGPVCVIITINTVLLTGTMWILRQKLSSVNAEVSTLKDT
Download sequence
Identical sequences ENSDORP00000012445 ENSDORP00000012445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]