SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012502 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012502
Domain Number 1 Region: 150-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.06e-70
Family Nuclear receptor ligand-binding domain 0.00000774
Further Details:      
 
Domain Number 2 Region: 82-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-30
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012502   Gene: ENSDORG00000013299   Transcript: ENSDORT00000013298
Sequence length 421
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4679:28341:37212:-1 gene:ENSDORG00000013299 transcript:ENSDORT00000013298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSSWRDPQDDVAGGNPGGSNPAAQAARGGGGAGEQQQAGSGAPHTPQTPGQPGAPA
TPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTFTC
RANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGH
CYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPD
LQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIF
QEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPN
QPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQC
S
Download sequence
Identical sequences ENSDORP00000012502 ENSDORP00000012502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]