SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012574 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012574
Domain Number 1 Region: 8-324
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-55
Family Ankyrin repeat 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012574   Gene: ENSDORG00000013375   Transcript: ENSDORT00000013374
Sequence length 992
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2755:24232:48263:1 gene:ENSDORG00000013375 transcript:ENSDORT00000013374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERQALVASRDGDVATLERLLEAGALGPGITDALGAGLVHHATRAGHLDCVKFLVERAK
LPSNQQAHNGATPVHDAAATGNLAELRWLVRDGGCGLQDQDASGVSPLHLAARFGHPTVV
EWLLREGHAATLETQEGALPLHHAAVSGDLTCLKLLTVAHSSGVNQRTRSGASPLYLACQ
EGHLHLAQFLVKDCGADVRLRALDGMSALHAAAARGHYSLVVWLATFTDISLTARDNEGA
TALHFAARGGHTPILDRLLLLGAPIMRDSWGGTPLHDAAENGQMECCQTLLSHRVDPSLR
DEDGYTAADLAEYHGHQDCAQYLRGMAQPVPILMTPPPPPFPPPPLSAARLSVEDGGRGG
SQLRSPPPVTLSPAWPGQPGPREPPASTASPGATSTPATAEGAEMAAGEAPEGLAALQLD
VLPSGDLDGLVPTQDELGRPIPEWKRQVMVRKLQARLGTGPLLDPEAQDDSGGPGPGEPA
AWRYSQAHRAILGPFGELLTEDDLVYLEKQIADLQLRRRCEEYESELGRLAAELQALLPE
PLVRITVNSHFLPRPPGPEDEEAPAPAAEPEGPAGAEKTGPGGQPLPFWCSHIARLVRSL
SLLLTGVNGLGQSEGKAAAPGPLDTCRGVPAGPPRSDAQREIQECGVSVRTLRGNFELAP
GLPCALNLGPGEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCEEAPS
EGGAGSDLASLRKERIITLFLSHWKKSAYTPALKTAACRTLEVHRTRSRGQEAARSPEPP
PPPSEGPRLSHLWQQRGIITHLLGNWKAIMAHVPARQLRRLSRRPQGPLSPEQFLPHVDG
APVPYGSLSLDLFMLGYFQLLECDLPAEERKMRHLLCFEVFEHLGAHGWEAVRTFHKAVT
DEVASGRRAWTDGFEDIKARFFGTSQGPSWDMEPGRKLGLSPLRPLVPEPAAPRLQSGAQ
QGSFNNEDICGYIDRSFAFWKEKEAEMFHFGE
Download sequence
Identical sequences ENSDORP00000012574 ENSDORP00000012574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]