SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012793 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012793
Domain Number 1 Region: 55-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-18
Family Nuclear receptor 0.00046
Further Details:      
 
Domain Number 2 Region: 106-120,166-173,251-316
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000144
Family Nuclear receptor ligand-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 382-446
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000008
Family Nuclear receptor ligand-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012793   Gene: ENSDORG00000013606   Transcript: ENSDORT00000013605
Sequence length 460
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3830:24515:124903:-1 gene:ENSDORG00000013606 transcript:ENSDORT00000013605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDERPPSGGGGFCQDELTELDPGTXXXXXXXXXXXXXXXXXXXXXXXXXXXSISCEGC
KGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRN
KSIGPVQISEEEIERIMSGQEFEEETNHWSNHGDSDHSSPGNRASESNQPSPGSTLSSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXYAVTQAELFALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLL
SSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDEELHXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDL
MMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTNVVKE
Download sequence
Identical sequences ENSDORP00000012793 ENSDORP00000012793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]