SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012810 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012810
Domain Number 1 Region: 1155-1220
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-20
Family TB module/8-cys domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 1327-1389
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 362-432
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000824
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 4 Region: 730-848
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 816-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 683-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000111
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 7 Region: 428-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 8 Region: 1055-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000345
Family EGF-type module 0.022
Further Details:      
 
Domain Number 9 Region: 1434-1479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000247
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1464-1515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000591
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1271-1316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000774
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 12 Region: 973-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000608
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 13 Region: 214-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000072
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 2-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000639
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012810
Domain Number - Region: 1232-1280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00138
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1100-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00948
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012810   Gene: ENSDORG00000013625   Transcript: ENSDORT00000013625
Sequence length 1530
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_293:7123:353564:1 gene:ENSDORG00000013625 transcript:ENSDORT00000013625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCVPPCQNGGMCLRPQLCVCKPGTQGKACETAAAQETSSPIFGGQNPGVVSSWVLSEQAA
KHTSSKKADALPRVSPVAQMTLTLKPKPAIGLSQQIHSQVARLSSQNVMIHHGQTQEYVL
KPKYFPAQKLISGEQAMEGLLPLRYGQDPVASPFHLSNHTGRIKVVFTPSICKVTCTKGS
CQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKL
CQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTLPLTMTSQQVKVKFPPNIVNIHVKHP
PEASVQIHQVSRIDGPTGQKVKESQPGQSQVSYQGLPAQKTQTAHSTYPHQQLLPHVYPV
AAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHAYSQML
ECLQGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCTCKRGFGPDATFSSCVXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFKETCP
GGLGYTVSGVHRRRPIHHHVGKGPLFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREH
RPGAAEPEVATAAPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQYPGIVIEKTSPPV
PVEIAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYKFSEQ
QRKCVDIDECAQVQHLCSQGRCENTEGSFLCICPAGFMASEAGTNCIDVDECLRADVCGD
GHCVNTMGAFRCEYCDSGYRMTRRGRCEDIDECLTPSTCPDEQCVNSPGSYQCVPCTEGF
RGWNGQCVDVDECLEPNVCTNGSCANLEGSYMCSCHRGYSPTPDHRRCQDIDECQQGNLC
MNGQCKNTDGSFRCTCGQGYQLSAAEDQCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXINECLEDKSVCQGGDCINTPGSYDCTCPAGFQINDNRQCQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDECVNNTICDSHGFCDNTAGSFRC
LCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADETQEYSPMTGQCRS
RVSELDVDVDQPREEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCP
VLGTAEFAEMCPGGKGFVPAGESSYNTGGENYKDADECVLFGQEICKNGFCLNTQPYECY
CKQETYYDPVKLQCFDLDECQDPNSCVDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPTE
SNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSD
DYAQLCNIPVSGRRQPYGRDALVDFSEQYAPEADPYFIQDRFLNSFEELQAEECGILNGC
ENGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCL
CLPGFVPSDKPNYCTPLNTALSLEKDSDLE
Download sequence
Identical sequences ENSDORP00000012810 ENSDORP00000012810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]