SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013327 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013327
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.98e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 689-698,820-859
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000068
Family Formin homology 2 domain (FH2 domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013327   Gene: ENSDORG00000014175   Transcript: ENSDORT00000014175
Sequence length 1162
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6613:37026:52910:-1 gene:ENSDORG00000014175 transcript:ENSDORT00000014175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSDSTSTAMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSTSATHGGGPLPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGSQAQPSQLPPQTPTMAPELVSLSSQPSETVESEAPPREPMEAEETEERAPAQ
SPELTPSGPAPVGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAA
TTDYNNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDAGTQPGGVPSAPTGPLGPSGHG
QTLGSTLIQLPSLSPEFMHAVAHQITHQAMVAAVASAATGQQVPGFPTAPTRVVIARPTP
PQARPSHPGGPPGSGAMQGSGVGTNTSLAQMVSGLVGQLLMQPVLVAQGTPGMAPSPAPA
TASASAGTTNTATTAGPAPGGPAQPPPPQPSTADLQFSQLLGNLLGPTGPGAGGPGVASP
TITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPPAPEQQTTPPPGSPSGGTGSPG
SLGPESLPPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALG
FFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATH
TLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDNGFGARLLELC
NQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHM
PVGPDAILRYVRRIGDPPQPLSEEPMEVQGAERTSPEPQRENASPAPGTTAEEAMSRGPP
PAPEGGSRDEQDGASTETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAK
RRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIKRL
QKDPNYTPQRFPNTHRAFADDP
Download sequence
Identical sequences ENSDORP00000013327 ENSDORP00000013327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]