SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013563 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013563
Domain Number 1 Region: 24-133
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.44e-35
Family PDI-like 0.0031
Further Details:      
 
Domain Number 2 Region: 341-483
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.33e-34
Family PDI-like 0.00019
Further Details:      
 
Domain Number 3 Region: 238-375
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000236
Family PDI-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013563   Gene: ENSDORG00000014424   Transcript: ENSDORT00000014424
Sequence length 505
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5021:226:25659:1 gene:ENSDORG00000014424 transcript:ENSDORT00000014424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRHLALFSVVALLLAEARHAAASDVLELTDDNFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGITLFRPSHLANKFEDKTVAYTEQKMTSGKIKKFIQENI
FDICPHMTEDNKDLIQGKDLLMAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKAFSHELSDFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGS
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNDDKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLSPKKYEGGRELSDFISYL
QREATNPPIIQEEKPKKKKKAQEDL
Download sequence
Identical sequences ENSDORP00000013563 ENSDORP00000013563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]